PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0654s0015.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 326aa    MW: 36436.9 Da    PI: 7.2998
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0654s0015.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like101.55.3e-32196251156
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                          k+r++W+peLH+rFv+a++qLGGse+AtP++i+++m v+gLt+++vkSHLQkYRl+
  Kalax.0654s0015.1.p 196 KQRRCWSPELHRRFVDALQQLGGSEVATPRQIRDIMRVEGLTNDEVKSHLQKYRLH 251
                          79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466895.73E-17194254IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.603.9E-28195254IPR009057Homeodomain-like
PROSITE profilePS512949.516195253IPR017930Myb domain
TIGRFAMsTIGR015573.0E-26196251IPR006447Myb domain, plants
PfamPF002491.1E-6198249IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 326 aa     Download sequence    Send to blast
MDPIPTRDFL KFDDPPRRKL QRLADHVAGL EAERRKIEAF KRELPLCLDL LNDAVERFRE  60
ELRKCGDGGA ADCNCDKVEG PNSENDNDMK SWMSSVKLWN HHANDSPDFN STSSNVKSMI  120
EAEAVAENAG GAKMEIKGNS GDEVSLMKPV HAVARTVELE QLCGESARNL NRGKTLVHEL  180
KMQKKIQQAQ EQVGRKQRRC WSPELHRRFV DALQQLGGSE VATPRQIRDI MRVEGLTNDE  240
VKSHLQKYRL HMRKAPASTA SQDDPRQPLH SKSHSIISPQ GPLDAKRSAA SGNYSASVLD  300
AEEAEEENEG HSWRGGVLFR PACRC*
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00629PBMTransfer from PK14402.1Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.12e-48G2-like family protein